Gaiad: Chapter 27

The Great Stabilization

Sagittarius 27 · Day of Year 27

From Anu's unique lineage came Two sons of very different fame: Bold Enki, seeker of the sea, And Homos, keeping family. While Homos chose his father's way, Content to live as they always stay, Great Enki felt adventure's call To sail beyond the harbor wall. "I shall explore the ocean wide," Declared brave Enki with great pride. "My creatures shall both move and scurry Through seas and lands without worry." He built a galley, great and grand, The finest vessel in the land. With millions of oars arrayed, His mighty barge was made. His head faced forward to the sea, His men rowed powerfully. Through waves both high and low, They made their vessel go. But soon great Enki found his plight: Lost in the endless night. No landmarks could he see, Adrift upon the sea. "I need wise men," brave Enki said, "To guide where we are led. Bring me astrologers so keen To read what stars have seen." The Flamens came, his priestly band, Flask cells from the land. These stargazers would divine The paths through space and time. The Flamens looked into the sky And saw with their trained eye Rich larvae floating by With yolks that multiply. "Here," they said, "the signs are right To build beneath this sight. The stars align above To bless what we love." But as they prayed for guidance true, The gods came into view. Each brought a sacred gift, To help their spirits lift. Dark Tyrosine the Devil came With three spells of flame: Adrenaline's rush so bright, Noradrenaline's fight, And Dopamine's delight. Then Tryptophanes the Sun Blessed them, every one, With Serotonin's day And Melatonin's way. For twilight's mystic hour, He brought DMT's power. The sacred visions came In the twilight's name. Glutama the Empress brought The balance that she taught: GABA's calming peace And Glutamate's release. "We need more spells," said Enki wise, "To help our people rise. If Jehovah's will be done, More magic must be won." Great Mithra heard his plea And blessed him by the sea With Acetylcholine's might To coordinate their sight. Fair Iodina, mother great, Revealed love's incarnate: The sacred CYIQNCPLG, Oxytocin's key. Then Kali, dark and deep, Gave spells to soothe and keep: Three endorphins strong To right what has gone wrong. Alpha's sequence clear: YGGFMTSEKSQTPLVT here. Beta's longer chain: YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE's refrain. Gamma's shorter form: YGGFMTSEKSQTPLVTL in the storm. These became the tools That break pain's rules: Opium's ancient call, Morphine for all, Heroin's dark embrace, Fentanyl's dangerous face. All these incantations blessed Became the chemicals that test The nervous system's might: Neurotransmitters' light. The Flamens learned to spear The larvae swimming near. Coordinated, they became Nematocysts by name. Their hunting grew precise As they struck once and twice. Their spears would never miss Their targets in the abyss. Soon cables stretched between The hunters, long and keen. Telegraph wires of old Became nerves, brave and bold. And this is why today Priests carry, so they say, Spears and wires combined To serve the sacred mind. Through neural networks wide, Enki's people could provide Robotic arms so strong Around their city's song. These arms would catch with ease The larvae from the seas. His power grew and grew As his great city flew. He covered tentacles all With Choanocytes' call, To catch both great and small Fish that rise and fall. Enki's city was a sight Of technological might. Proto-animal in form, It weathered every storm. From Enki came two sons When his great work was done: Bold Paraxus the strong And Xiangus life long. Now Xiangus took the way Of robotic arms' display. His fishermen arranged On arms that never changed. From Xiangus came the line Of Daihua so fine. Whose beauty was renowned Wherever she was found. From Daihua's noble race Came Dinomischus' grace. A creature strange and tall Who towered over all. And from this ancient lord Came Siphus, by accord The ancestor of all The comb jellies' call. These Ctenophores so bright Move with rainbow light. Their combs catch the sun As through waves they run. But Paraxus the great Would found a different state. His lineage would grow To realms we yet don't know. Far greater nations he Would father by the sea. His legacy would span The future's plan. From Enki's bold design Came the neural line. The nervous system's start Played its crucial part. The chemicals that flow Through minds both high and low Were born upon that day When Enki sailed away. In every thought we think, In every neural link, Enki's ancient quest Lives on in our breast. The neurotransmitters' dance In every glance Recalls that fateful hour When gods gave their power. So honor brave Enki, Who sailed the endless sea. His courage and his quest Gave neurons to our nest. The Flamens' starry sight, The nematocysts' might, The neural networks vast All came from ages past. In every brain that thinks, In every nerve that links, The echo still rings true Of Enki's journey through. The animals that move With coordinated groove All trace their lineage back To Enki's neural track. From sponge to human mind, The pattern still we find: The nervous system's art Connects each beating heart.
Wiki
Help improve this page on the wiki.
Go to the wiki page